PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F01513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 923aa    MW: 100854 Da    PI: 5.0143
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F01513.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-185096148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
   Pahal.F01513.1 50 KGNWTPEEDAILSRAVQTYQGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                     79******************************.************986 PP

2Myb_DNA-binding62.21.1e-19102148148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
   Pahal.F01513.1 102 KGPWSKEEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                      79******************************.*************97 PP

3Myb_DNA-binding47.34.7e-15154196145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE+  l++a++++G++ W+   + ++ gRt++ +k++w+
   Pahal.F01513.1 154 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 196
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6774596IPR017930Myb domain
SuperFamilySSF466896.21E-1948110IPR009057Homeodomain-like
SMARTSM007173.1E-174998IPR001005SANT/Myb domain
PfamPF002493.7E-165096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-2451104IPR009057Homeodomain-like
CDDcd001676.25E-155296No hitNo description
PROSITE profilePS5129431.9297152IPR017930Myb domain
SuperFamilySSF466892.23E-3199195IPR009057Homeodomain-like
SMARTSM007171.5E-18101150IPR001005SANT/Myb domain
CDDcd001672.66E-16104148No hitNo description
Gene3DG3DSA:1.10.10.604.7E-27105151IPR009057Homeodomain-like
PfamPF139212.9E-18105165No hitNo description
Gene3DG3DSA:1.10.10.607.0E-21152203IPR009057Homeodomain-like
PROSITE profilePS5129419.654153203IPR017930Myb domain
SMARTSM007174.4E-14153201IPR001005SANT/Myb domain
CDDcd001676.42E-11156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    Send to blast
MASDKAKVAK KGGEDPGLPP APREGENSHE PQRQRSLNGR TTGPTRRSTK GNWTPEEDAI  60
LSRAVQTYQG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIVQMVNKY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP AINKEAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNA IKNHWNSSVK KKVDSYISSG LLSQAPCLPV IECPAQCNSL SAMNLQNNGD  240
SGCNAHNTNV ALNCELQVNV DANKGEAHDS HSSMCQGACY TSIEAVGSAL PDGHHHLSSS  300
FSQRTDLQMD VNEGSGNSVF ADDQTLCSTS NQEKSMVPYG VVQEMPVSVL SSVSEAEQTL  360
HLISDADSLK SELWKDVSLQ ILISGDTIDG DSSSGLNQLP DTSETDTNFL AQPYPLHTSN  420
PSSVMETVYE QSTLETISPS SICLHSLPDA PENRSEPIEM PDSEAEMITC SNNSFCDAEQ  480
SAKPGSSDDR PGAFTMTESI TNCRSQQSTD AEEPVASTAK ERLPKDMDTV PDEKKGEGAL  540
FYEPPRFPGL DVPFISCDLV TSADMQEFSP LGIRQWMRST MNVPTPLRLW GSPTHDESPG  600
VLKSAAESFP CAPSIMKKRQ RGLLSPTPDK RIEKKSGIAK EMTDISYMIA ATCSMNATKD  660
EATAPESAAC AEQYSSFKHL DEKENFNGAP EQARDPQNGG NEQGGQQCSS LNVANPNTDL  720
PDNLQPVGIL VEHNCNDITA ADHGAKPESL SFCKEAVSSK PKPAELVVEK SSPCINADYE  780
YVNLLADTPG VKRGLESPSA WKSPWYIDMH MHFQGFVSPA DRTYDALGLV KQISKQSAAA  840
AVEACEVLAS GSRISDKENK ENRDDKEPGT RKSQTKIMAE ARVLDFDEYS TPAKAADKRL  900
GSCLGRSVSS PILSSPNLRS FR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-67502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-67502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0875061e-152BT087506.1 Zea mays full-length cDNA clone ZM_BFb0098J09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967414.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLK3XEN20.0K3XEN2_SETIT; Uncharacterized protein
STRINGSi000349m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-104Homeodomain-like protein